PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_17643
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family HB-other
Protein Properties Length: 136aa    MW: 15609.9 Da    PI: 9.0635
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_17643genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.24.3e-161451256
                HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox 12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                ++e+e+l +++++p+ ++r +L+++lgL+ +qVk+WFqNrR+++k
  PEQU_17643  1 IQEMEALSKECPHPDDKQRLRLSQELGLKPCQVKFWFQNRRTQMK 45
                6899**************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000469.9E-14145IPR001356Homeobox domain
CDDcd000865.23E-12148No hitNo description
PROSITE profilePS5007113.896147IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.5E-15250IPR009057Homeodomain-like
SMARTSM003892.0E-5251IPR001356Homeobox domain
SuperFamilySSF466895.01E-13247IPR009057Homeodomain-like
PROSITE patternPS0002702245IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
IQEMEALSKE CPHPDDKQRL RLSQELGLKP CQVKFWFQNR RTQMKAQKDR GAENDSLKNE  60
NYRLQAAIHV ICPSCGGPVI LGEMSFDEHH PRIENARLKE DSQNKPRNNV FSSKGKVPPF  120
PSLKKADEKC VLTILQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919976.17e-50PREDICTED: homeobox-leucine zipper protein ROC3-like
SwissprotA2ZAI71e-43ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
SwissprotQ336P21e-43ROC3_ORYSJ; Homeobox-leucine zipper protein ROC3
TrEMBLS8DFA86e-49S8DFA8_9LAMI; Uncharacterized protein (Fragment)
TrEMBLA0A059CHR54e-48A0A059CHR5_EUCGR; Uncharacterized protein (Fragment)
STRINGGSMUA_Achr4P19010_0011e-46(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5628322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.12e-40protodermal factor 2